Recombinant Full Length Human SLC22A2 Protein, GST-tagged
Cat.No. : | SLC22A2-6816HF |
Product Overview : | Recombinant Human SLC22A2 Full-Length ORF Protein (1-555 aa) is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 555 amino acids |
Description : | Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 89 kDa |
AA Sequence : | MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHRCRSPGVAELSLRCGWSPAEELNYTVPGPGPAGEASPRQCRRYEVDWNQSTFDCVDPLASLDTNRSRLPLGPCRDGWVYETPGSSIVTEFNLVCANSWMLDLFQSSVNVGFFIGSMSIGYIADRFGRKLCLLTTVLINAAAGVLMAISPTYTWMLIFRLIQGLVSKAGWLIGYILITEFVGRRYRRTVGIFYQVAYTVGLLVLAGVAYALPHWRWLQFTVALPNFFFLLYYWCIPESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIRKHTMILMYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFMIILTIDRIGRRYPWAASNMVAGAACLASVFIPGDLQWLKIIISCLGRMGITMAYEIVCLVNAELYPTFIRNLGVHICSSMCDIGGIITPFLVYRLTNIWLELPLMVFGVLGLVAGGLVLLLPETKGKALPETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SLC22A2 solute carrier family 22 (organic cation transporter), member 2 [ Homo sapiens ] |
Official Symbol | SLC22A2 |
Synonyms | SLC22A2; OCT2; MGC32628; |
Gene ID | 6582 |
mRNA Refseq | NM_003058 |
Protein Refseq | NP_003049 |
MIM | 602608 |
UniProt ID | O15244 |
◆ Recombinant Proteins | ||
SLC22A2-670H | Recombinant Human SLC22A2 Protein, GST-tagged | +Inquiry |
SLC22A2-5455R | Recombinant Rat SLC22A2 Protein | +Inquiry |
SLC22A2-12366Z | Recombinant Zebrafish SLC22A2 | +Inquiry |
SLC22A2-0674H | Recombinant Human SLC22A2 Protein (P2-N555), 8×His-Strep, Flag tagged | +Inquiry |
SLC22A2-6816HF | Recombinant Full Length Human SLC22A2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC22A2-1795HCL | Recombinant Human SLC22A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC22A2 Products
Required fields are marked with *
My Review for All SLC22A2 Products
Required fields are marked with *
0
Inquiry Basket