Recombinant Full Length Human SLC29A2 Protein, C-Flag-tagged
Cat.No. : | SLC29A2-1812HFL |
Product Overview : | Recombinant Full Length Human SLC29A2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The uptake of nucleosides by transporters, such as SLC29A2, is essential for nucleotide synthesis by salvage pathways in cells that lack de novo biosynthetic pathways. Nucleoside transport also plays a key role in the regulation of many physiologic processes through its effect on adenosine concentration at the cell surface. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.9 kDa |
AA Sequence : | MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNW VTLLSQLPLLLFTLLNSFLYQCVPETVRILGSLLAILLLFALTAALVKVDMSPGPFFSITMASVCFINSF SAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLLSMASGVDAETSALGYFITPCVGILMSIVCY LSLPHLKFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGK PSVFTVFQKIWLTALCLVLVFTVTLSVFPAITAMVTSSTSPGKWSQFFNPICCFLLFNIMDWLGRSLTSY FLWPDEDSRLLPLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLVSLTMCLAPR QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | SLC29A2 solute carrier family 29 member 2 [ Homo sapiens (human) ] |
Official Symbol | SLC29A2 |
Synonyms | ENT2; DER12; HNP36 |
Gene ID | 3177 |
mRNA Refseq | NM_001532.3 |
Protein Refseq | NP_001523.2 |
MIM | 602110 |
UniProt ID | Q14542 |
◆ Recombinant Proteins | ||
SLC29A2-5152R | Recombinant Rat SLC29A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slc29a2-5918M | Recombinant Mouse Slc29a2 Protein, Myc/DDK-tagged | +Inquiry |
SLC29A2-2059Z | Recombinant Zebrafish SLC29A2 | +Inquiry |
SLC29A2-1812HFL | Recombinant Full Length Human SLC29A2 Protein, C-Flag-tagged | +Inquiry |
SLC29A2-15356M | Recombinant Mouse SLC29A2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC29A2-1742HCL | Recombinant Human SLC29A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC29A2 Products
Required fields are marked with *
My Review for All SLC29A2 Products
Required fields are marked with *
0
Inquiry Basket