Recombinant Full Length Human SLC39A4 Protein, C-Flag-tagged
Cat.No. : | SLC39A4-796HFL |
Product Overview : | Recombinant Full Length Human SLC39A4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the zinc/iron-regulated transporter-like protein (ZIP) family. The encoded protein localizes to cell membranes and is required for zinc uptake in the intestine. Mutations in this gene result in acrodermatitis enteropathica. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 68.2 kDa |
AA Sequence : | MASLVSLELGLLLAVLVVTATASPPAGLLSLLTSGQGALDQEALGGLLNTLADRVHCTNGPCGKCLSVED ALGLGEPEGSGLPPGPVLEARYVARLSAAAVLYLSNPEGTCEDTRAGLWASHADHLLALLESPKALTPGL SWLLQRMQARAAGQTPKTACVDIPQLLEEAVGAGAPGSAGGVLAALLDHVRSGSCFHALPSPQYFVDFVF QQHSSEVPMTLAELSALMQRLGVGREAHSDHSHRHRGASSRDPVPLISSSNSSSVWDTVCLSARDVMAAY GLSEQAGVTPEAWAQLSPALLQQQLSGACTSQSRPPVQDQLSQSERYLYGSLATLLICLCAVFGLLLLTC TGCRGVTHYILQTFLSLAVGALTGDAVLHLTPKVLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLF NLLLPRDPEDLEDGPCGHSSHSHGGHSHGVSLQLAPSELRQPKPPHEGSRADLVAEESPELLNPEPRRLS PELRLLPYMITLGDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSVRQALL LNLASALTAFAGLYVALAVGVSEESEAWILAVATGLFLYVALCDMLPAMLKVRDPRPWLLFLLHNVGLLG GWTVLLLLSLYEDDITFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | SLC39A4 solute carrier family 39 member 4 [ Homo sapiens (human) ] |
Official Symbol | SLC39A4 |
Synonyms | AEZ; ZIP4; AWMS2 |
Gene ID | 55630 |
mRNA Refseq | NM_130849.4 |
Protein Refseq | NP_570901.3 |
MIM | 607059 |
UniProt ID | Q6P5W5 |
◆ Recombinant Proteins | ||
SLC39A4-2032H | Recombinant Human SLC39A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC39A4-5983H | Recombinant Human SLC39A4 Protein (Ser23-Tyr327), N-His tagged | +Inquiry |
RFL33943RF | Recombinant Full Length Rat Zinc Transporter Zip4(Slc39A4) Protein, His-Tagged | +Inquiry |
Slc39a4-2074M | Recombinant Mouse Slc39a4 Protein, His-tagged | +Inquiry |
SLC39A4-796HFL | Recombinant Full Length Human SLC39A4 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A4-1719HCL | Recombinant Human SLC39A4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC39A4 Products
Required fields are marked with *
My Review for All SLC39A4 Products
Required fields are marked with *
0
Inquiry Basket