Recombinant Full Length Human SLURP1 Protein, C-Flag-tagged
Cat.No. : | SLURP1-801HFL |
Product Overview : | Recombinant Full Length Human SLURP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 8.9 kDa |
AA Sequence : | MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | SLURP1 secreted LY6/PLAUR domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | SLURP1 |
Synonyms | ARS; MDM; ANUP; ArsB; LY6LS; LY6-MT |
Gene ID | 57152 |
mRNA Refseq | NM_020427.3 |
Protein Refseq | NP_065160.1 |
MIM | 606119 |
UniProt ID | P55000 |
◆ Recombinant Proteins | ||
SLURP1-8454M | Recombinant Mouse SLURP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLURP1-2333H | Recombinant Human SLURP1 Protein (23-103 aa), His-tagged | +Inquiry |
SLURP1-2933HFL | Recombinant Full Length Human SLURP1 protein, Flag-tagged | +Inquiry |
SLURP1-135H | Recombinant Human SLURP1 protein, His-tagged | +Inquiry |
Slurp1-1953M | Recombinant Mouse Slurp1 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLURP1-1642HCL | Recombinant Human SLURP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLURP1 Products
Required fields are marked with *
My Review for All SLURP1 Products
Required fields are marked with *