Recombinant Full Length Human SLURP1 Protein, C-Flag-tagged
| Cat.No. : | SLURP1-801HFL |
| Product Overview : | Recombinant Full Length Human SLURP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 8.9 kDa |
| AA Sequence : | MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVT RSCSSSCVATDPDSIGAAHLIFCCFRDLCNSELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Secreted Protein |
| Full Length : | Full L. |
| Gene Name | SLURP1 secreted LY6/PLAUR domain containing 1 [ Homo sapiens (human) ] |
| Official Symbol | SLURP1 |
| Synonyms | ARS; MDM; ANUP; ArsB; LY6LS; LY6-MT |
| Gene ID | 57152 |
| mRNA Refseq | NM_020427.3 |
| Protein Refseq | NP_065160.1 |
| MIM | 606119 |
| UniProt ID | P55000 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLURP1 Products
Required fields are marked with *
My Review for All SLURP1 Products
Required fields are marked with *



