Recombinant Full Length Human SMIM14 Protein, GST-tagged

• Cat.No.: SMIM14-3893HF
• Product Overview: Human C4orf34 full-length ORF (AAH08502.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 99 amino acids
• Description: SMIM14 (Small Integral Membrane Protein 14) is a Protein Coding gene.
• Molecular Mass: 37.29 kDa
• AA Sequence: MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SMIM14 small integral membrane protein 14 [ Homo sapiens (human) ]
• Official Symbol: SMIM14
• Synonyms: Small Integral Membrane Protein 14; C4orf34; Chromosome 4 Open Reading Frame 34; SMIM14; small integral membrane protein 14; small integral membrane protein 14
• Gene ID: 201895
• mRNA Refseq: NM_001317896
• Protein Refseq: NP_001304825
• UniProt ID: Q96QK8