| Species : | 
                                    Human | 
                                
                                
                                    | Source : | 
                                    Mammalian Cells | 
                                
                                
                                    | Tag : | 
                                    Flag | 
                                
                                
                                    | Description : | 
                                    This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene. | 
                                
                                
                                    | Form : | 
                                    25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. | 
                                
                                
                                    | Molecular Mass : | 
                                    28.8 kDa | 
                                
                                
                                    | AA Sequence : | 
                                    MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYES EKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTS QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELS MGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
                                
                                
                                    | Purity : | 
                                    > 80% as determined by SDS-PAGE and Coomassie blue staining. | 
                                
                                
                                    | Stability : | 
                                    Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
                                
                                
                                    | Storage : | 
                                    Store at -80 centigrade. | 
                                
                                
                                    | Concentration : | 
                                    >50 ug/mL as determined by microplate BCA method. | 
                                
                                
                                    | Preparation : | 
                                    Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
                                
                                
                                    | Protein Families : | 
                                    Druggable Genome | 
                                
                                
                                    | Protein Pathways : | 
                                    SNARE interactions in vesicular transport | 
                                
                                
                                    | Full Length : | 
                                    Full L. |