Recombinant Full Length Human SNAPIN Protein, C-Flag-tagged
Cat.No. : | SNAPIN-2091HFL |
Product Overview : | Recombinant Full Length Human SNAPIN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 14.7 kDa |
AA Sequence : | MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINE DQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SNAPIN SNAP associated protein [ Homo sapiens (human) ] |
Official Symbol | SNAPIN |
Synonyms | BLOS7; BORCS3; SNAPAP; BLOC1S7 |
Gene ID | 23557 |
mRNA Refseq | NM_012437.6 |
Protein Refseq | NP_036569.1 |
MIM | 607007 |
UniProt ID | O95295 |
◆ Recombinant Proteins | ||
SNAPIN-15672M | Recombinant Mouse SNAPIN Protein | +Inquiry |
SNAPIN-4365R | Recombinant Rhesus monkey SNAPIN Protein, His-tagged | +Inquiry |
SNAPAP-691H | Recombinant Human SNAPAP Protein, His-tagged | +Inquiry |
SNAPIN-30508TH | Recombinant Human SNAPIN, His-tagged | +Inquiry |
SNAPIN-4181R | Recombinant Rhesus Macaque SNAPIN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAPIN-1635HCL | Recombinant Human SNAPIN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAPIN Products
Required fields are marked with *
My Review for All SNAPIN Products
Required fields are marked with *
0
Inquiry Basket