Recombinant Full Length Human SNRPC Protein, C-Flag-tagged

Cat.No. : SNRPC-1005HFL
Product Overview : Recombinant Full Length Human SNRPC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 17.2 kDa
AA Sequence : MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAP PPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMR
PPARPMMVPTRPGMTRPDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Stem cell - Pluripotency
Protein Pathways : Spliceosome
Full Length : Full L.
Gene Name SNRPC small nuclear ribonucleoprotein polypeptide C [ Homo sapiens (human) ]
Official Symbol SNRPC
Synonyms U1C; Yhc1
Gene ID 6631
mRNA Refseq NM_003093.3
Protein Refseq NP_003084.1
MIM 603522
UniProt ID P09234

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNRPC Products

Required fields are marked with *

My Review for All SNRPC Products

Required fields are marked with *

0
cart-icon