Recombinant Full Length Human SNRPC Protein, C-Flag-tagged
Cat.No. : | SNRPC-1005HFL |
Product Overview : | Recombinant Full Length Human SNRPC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.2 kDa |
AA Sequence : | MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAP PPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMR PPARPMMVPTRPGMTRPDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Stem cell - Pluripotency |
Protein Pathways : | Spliceosome |
Full Length : | Full L. |
Gene Name | SNRPC small nuclear ribonucleoprotein polypeptide C [ Homo sapiens (human) ] |
Official Symbol | SNRPC |
Synonyms | U1C; Yhc1 |
Gene ID | 6631 |
mRNA Refseq | NM_003093.3 |
Protein Refseq | NP_003084.1 |
MIM | 603522 |
UniProt ID | P09234 |
◆ Recombinant Proteins | ||
SNRPC-30583TH | Recombinant Human SNRPC | +Inquiry |
Snrpc-6006M | Recombinant Mouse Snrpc Protein, Myc/DDK-tagged | +Inquiry |
SNRPC-2822H | Recombinant Human SNRPC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNRPC-5785M | Recombinant Rhesus macaque SNRPC Protein (Met1-Arg159), N-His tagged | +Inquiry |
SNRPC-9525Z | Recombinant Zebrafish SNRPC | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPC-616HCL | Recombinant Human SNRPC lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNRPC Products
Required fields are marked with *
My Review for All SNRPC Products
Required fields are marked with *
0
Inquiry Basket