Recombinant Full Length Human SOHLH2 Protein, GST-tagged

Cat.No. : SOHLH2-4888HF
Product Overview : Human FLJ20449 full-length ORF ( AAH25383, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 225 amino acids
Description : This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis. This gene is located on chromosome 13. The proteins encoded by this gene and another testis-specific transcription factor, SOHLH1, can form heterodimers, in addition to homodimers. There is a read-through locus (GeneID: 100526761) that shares sequence identity with this gene and the upstream CCDC169 (GeneID: 728591). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]
Molecular Mass : 50.49 kDa
AA Sequence : MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SOHLH2 spermatogenesis and oogenesis specific basic helix-loop-helix 2 [ Homo sapiens ]
Official Symbol SOHLH2
Synonyms SOHLH2; spermatogenesis and oogenesis specific basic helix-loop-helix 2; spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2; bHLHe81; FLJ20449; TEB1; FLJ57222;
Gene ID 54937
mRNA Refseq NM_017826
Protein Refseq NP_060296
MIM 616066
UniProt ID Q9NX45

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOHLH2 Products

Required fields are marked with *

My Review for All SOHLH2 Products

Required fields are marked with *

0
cart-icon
0
compare icon