Recombinant Full Length Human SOX2 Protein, C-Flag-tagged
Cat.No. : | SOX2-1613HFL |
Product Overview : | Recombinant Full Length Human SOX2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.1 kDa |
AA Sequence : | MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSE ISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA SGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSM TSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG AEVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Cancer stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Full Length : | Full L. |
Gene Name | SOX2 SRY-box transcription factor 2 [ Homo sapiens (human) ] |
Official Symbol | SOX2 |
Synonyms | ANOP3; MCOPS3 |
Gene ID | 6657 |
mRNA Refseq | NM_003106.4 |
Protein Refseq | NP_003097.1 |
MIM | 184429 |
UniProt ID | P48431 |
◆ Recombinant Proteins | ||
SOX2-2076H | Recombinant Human SOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOX2-837H | Recombinant Full Length Human SOX2 protein | +Inquiry |
SOX2-4229R | Recombinant Rhesus Macaque SOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOX2-3519H | Recombinant Human SOX2 protein, His-SUMO-tagged | +Inquiry |
SOX2-667H | Recombinant Human SOX2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SOX2-1561HCL | Recombinant Human SOX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX2 Products
Required fields are marked with *
My Review for All SOX2 Products
Required fields are marked with *
0
Inquiry Basket