Recombinant Full Length Human SPACA7 Protein, GST-tagged
Cat.No. : | SPACA7-1777HF |
Product Overview : | Human C13orf28 full-length ORF (1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 195 amino acids |
Description : | Predicted to act upstream of or within negative regulation of cell adhesion and single fertilization. Located in acrosomal vesicle. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MAVSQGDGTLCFVLLLCCWQETELRPRTVIPGSPTEIPFSSKQEDMSELLDEILVQEILDLNKTTPSEMPSTASTLSTPLHAGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQILQNIGRSSGNIFHKEQQRTSAQRRSQGSQ |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SPACA7 sperm acrosome associated 7 [ Homo sapiens ] |
Official Symbol | SPACA7 |
Synonyms | SPACA7; sperm acrosome associated 7; C13orf28, chromosome 13 open reading frame 28; protein SPACA7; sperm acrosome-associated protein 7; C13orf28; FLJ27356 |
Gene ID | 122258 |
mRNA Refseq | NM_145248 |
Protein Refseq | NP_660291 |
UniProt ID | Q96KW9 |
◆ Recombinant Proteins | ||
SPACA7-15806M | Recombinant Mouse SPACA7 Protein | +Inquiry |
SPACA7-1777HF | Recombinant Full Length Human SPACA7 Protein, GST-tagged | +Inquiry |
SPACA7-4107H | Recombinant Human SPACA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPACA7-8603M | Recombinant Mouse SPACA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPACA7-1321H | Recombinant Human SPACA7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPACA7-8300HCL | Recombinant Human C13orf28 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPACA7 Products
Required fields are marked with *
My Review for All SPACA7 Products
Required fields are marked with *