Recombinant Full Length Human SPACA7 Protein, GST-tagged

Cat.No. : SPACA7-1777HF
Product Overview : Human C13orf28 full-length ORF (1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 195 amino acids
Description : Predicted to act upstream of or within negative regulation of cell adhesion and single fertilization. Located in acrosomal vesicle.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 47.9 kDa
AA Sequence : MAVSQGDGTLCFVLLLCCWQETELRPRTVIPGSPTEIPFSSKQEDMSELLDEILVQEILDLNKTTPSEMPSTASTLSTPLHAGIDENYQAGGSENYHELLENLQFSPGIEDKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQILQNIGRSSGNIFHKEQQRTSAQRRSQGSQ
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPACA7 sperm acrosome associated 7 [ Homo sapiens ]
Official Symbol SPACA7
Synonyms SPACA7; sperm acrosome associated 7; C13orf28, chromosome 13 open reading frame 28; protein SPACA7; sperm acrosome-associated protein 7; C13orf28; FLJ27356
Gene ID 122258
mRNA Refseq NM_145248
Protein Refseq NP_660291
UniProt ID Q96KW9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPACA7 Products

Required fields are marked with *

My Review for All SPACA7 Products

Required fields are marked with *

0
cart-icon