Recombinant Full Length Human SPACA9 Protein, GST-tagged
| Cat.No. : | SPACA9-2729HF |
| Product Overview : | Human SPACA9 full-length ORF (NP_061829.3, 1 a.a. - 168 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 168 amino acids |
| Description : | SPACA9 (Sperm Acrosome Associated 9) is a Protein Coding gene. |
| Molecular Mass : | 45.7 kDa |
| AA Sequence : | MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEKLPRKVLQHGTT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SPACA9 sperm acrosome associated 9 [ Homo sapiens (human) ] |
| Official Symbol | SPACA9 |
| Synonyms | SPACA9; sperm acrosome associated 9; C9ORF9; chromosome 9 open reading frame 9; uncharacterized protein C9orf9; Rsb66 homolog; FLJ26879; |
| Gene ID | 11092 |
| mRNA Refseq | NM_018956 |
| Protein Refseq | NP_061829 |
| MIM | 618552 |
| UniProt ID | Q96E40 |
| ◆ Recombinant Proteins | ||
| SPACA9-2729HF | Recombinant Full Length Human SPACA9 Protein, GST-tagged | +Inquiry |
| Spaca9-6067M | Recombinant Mouse Spaca9 Protein, Myc/DDK-tagged | +Inquiry |
| SPACA9-0219H | Recombinant Human SPACA9 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPACA9 Products
Required fields are marked with *
My Review for All SPACA9 Products
Required fields are marked with *
