Recombinant Full Length Human SPACA9 Protein, GST-tagged

Cat.No. : SPACA9-2729HF
Product Overview : Human SPACA9 full-length ORF (NP_061829.3, 1 a.a. - 168 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 168 amino acids
Description : SPACA9 (Sperm Acrosome Associated 9) is a Protein Coding gene.
Molecular Mass : 45.7 kDa
AA Sequence : MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEKLPRKVLQHGTT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPACA9 sperm acrosome associated 9 [ Homo sapiens (human) ]
Official Symbol SPACA9
Synonyms SPACA9; sperm acrosome associated 9; C9ORF9; chromosome 9 open reading frame 9; uncharacterized protein C9orf9; Rsb66 homolog; FLJ26879;
Gene ID 11092
mRNA Refseq NM_018956
Protein Refseq NP_061829
MIM 618552
UniProt ID Q96E40

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPACA9 Products

Required fields are marked with *

My Review for All SPACA9 Products

Required fields are marked with *

0
cart-icon
0
compare icon