Recombinant Human SPACA9 Protein, GST-Tagged

• Cat.No.: SPACA9-0219H
• Product Overview: Human SPACA9 full-length ORF (NP_061829.3, 1 a.a. - 168 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: SPACA9 (Sperm Acrosome Associated 9) is a Protein Coding gene.
• Molecular Mass: 45.7 kDa
• AA Sequence: MNEVKESLRSIEQKYKLFQQQQLTFTAALEHCRENAHDKIRPISSIGQVQSYMEHYCNSSTDRRVLLMFLDICSELNKLCQHFEAVHSGTPVTNNLLEKCKTLVSQSNDLSSLRAKYPHDVVNHLSCDEARNHYGGVVSLIPLILDLMKEWIAHSEKLPRKVLQHGTT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPACA9 sperm acrosome associated 9 [ Homo sapiens (human) ]
• Official Symbol: SPACA9
• Synonyms: SPACA9; sperm acrosome associated 9; C9ORF9; chromosome 9 open reading frame 9; uncharacterized protein C9orf9; Rsb66 homolog; FLJ26879
• Gene ID: 11092
• mRNA Refseq: NM_018956
• Protein Refseq: NP_061829
• UniProt ID: Q96E40