Recombinant Full Length Human SPDYE2 Protein, GST-tagged

Cat.No. : SPDYE2-6258HF
Product Overview : Human MGC119295 full-length ORF ( NP_001026789.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 258 amino acids
Description : SPDYE2 (Speedy/RINGO Cell Cycle Regulator Family Member E2) is a Protein Coding gene. Among its related pathways are Oocyte meiosis. GO annotations related to this gene include protein kinase binding. An important paralog of this gene is SPDYE6.
Molecular Mass : 58.2 kDa
AA Sequence : MEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPSWQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKRWFQLGHSMNPRARKNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPDYE2 speedy/RINGO cell cycle regulator family member E2 [ Homo sapiens (human) ]
Official Symbol SPDYE2
Synonyms SPDYE2; speedy/RINGO cell cycle regulator family member E2; SPDYB2-L1; speedy protein E2; Speedy B2-like 1; putative Speedy protein E2; speedy homolog E2
Gene ID 441273
mRNA Refseq NM_001031618
Protein Refseq NP_001026789
MIM 617624
UniProt ID Q495Y8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPDYE2 Products

Required fields are marked with *

My Review for All SPDYE2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon