Recombinant Full Length Human SPDYE2 Protein, GST-tagged
Cat.No. : | SPDYE2-6258HF |
Product Overview : | Human MGC119295 full-length ORF ( NP_001026789.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 258 amino acids |
Description : | SPDYE2 (Speedy/RINGO Cell Cycle Regulator Family Member E2) is a Protein Coding gene. Among its related pathways are Oocyte meiosis. GO annotations related to this gene include protein kinase binding. An important paralog of this gene is SPDYE6. |
Molecular Mass : | 58.2 kDa |
AA Sequence : | MEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPSWQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKRWFQLGHSMNPRARKNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQKRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SPDYE2 speedy/RINGO cell cycle regulator family member E2 [ Homo sapiens (human) ] |
Official Symbol | SPDYE2 |
Synonyms | SPDYE2; speedy/RINGO cell cycle regulator family member E2; SPDYB2-L1; speedy protein E2; Speedy B2-like 1; putative Speedy protein E2; speedy homolog E2 |
Gene ID | 441273 |
mRNA Refseq | NM_001031618 |
Protein Refseq | NP_001026789 |
MIM | 617624 |
UniProt ID | Q495Y8 |
◆ Recombinant Proteins | ||
SPDYE2-4358H | Recombinant Human SPDYE2 Protein, GST-tagged | +Inquiry |
SPDYE2-6258HF | Recombinant Full Length Human SPDYE2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPDYE2-1523HCL | Recombinant Human SPDYE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPDYE2 Products
Required fields are marked with *
My Review for All SPDYE2 Products
Required fields are marked with *
0
Inquiry Basket