Recombinant Full Length Human SPRING1 Protein, GST-tagged

• Cat.No.: SPRING1-1754HF
• Product Overview: Human SPRING1 full-length ORF (BAB15058.1, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 205 amino acids
• Description: Involved in positive regulation of SREBP signaling pathway. Located in Golgi membrane.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 50 kDa
• AA Sequence: MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA
• Endotoxin: <0.1 ng/ug (<1 EU/ug)
• Storage: Store at -20 centigrade.Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPRING1 SREBF pathway regulator in golgi 1 [ Homo sapiens (human) ]
• Official Symbol: SPRING1
• Synonyms: C12ORF49; chromosome 12 open reading frame 49; UPF0454 protein C12orf49; FLJ21415
• Gene ID: 79794
• mRNA Refseq: NM_024738
• Protein Refseq: NP_079014
• UniProt ID: Q9H741