Recombinant Full Length Human SPRYD7 Protein, GST-tagged

• Cat.No.: SPRYD7-1769HF
• Product Overview: Human C13orf1 full-length ORF ( AAH22519.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 157 amino acids
• Description: SPRYD7 (SPRY Domain Containing 7) is a Protein Coding gene. Diseases associated with SPRYD7 include Conventional Lipoma.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.01 kDa
• AA Sequence: MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYDDDSAILDCQFSEFYHTPPPGFEKILFEQQIF
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPRYD7 SPRY domain containing 7 [ Homo sapiens (human) ]
• Official Symbol: SPRYD7
• Synonyms: CLLD6; C13orf1
• Gene ID: 57213
• mRNA Refseq: NM_020456
• Protein Refseq: NP_065189
• MIM: 607866
• UniProt ID: Q5W111