Recombinant Full Length Human SPRYD7 Protein, GST-tagged
Cat.No. : | SPRYD7-1769HF |
Product Overview : | Human C13orf1 full-length ORF ( AAH22519.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 157 amino acids |
Description : | SPRYD7 (SPRY Domain Containing 7) is a Protein Coding gene. Diseases associated with SPRYD7 include Conventional Lipoma. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 43.01 kDa |
AA Sequence : | MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYDDDSAILDCQFSEFYHTPPPGFEKILFEQQIF |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SPRYD7 SPRY domain containing 7 [ Homo sapiens (human) ] |
Official Symbol | SPRYD7 |
Synonyms | CLLD6; C13orf1 |
Gene ID | 57213 |
mRNA Refseq | NM_020456 |
Protein Refseq | NP_065189 |
MIM | 607866 |
UniProt ID | Q5W111 |
◆ Recombinant Proteins | ||
SPRYD7-5384R | Recombinant Rat SPRYD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPRYD7-519H | Recombinant Human SPRYD7 Protein, GST-tagged | +Inquiry |
SPRYD7-1769HF | Recombinant Full Length Human SPRYD7 Protein, GST-tagged | +Inquiry |
SPRYD7-5725R | Recombinant Rat SPRYD7 Protein | +Inquiry |
SPRYD7-2675H | Recombinant Human SPRYD7 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPRYD7-200HCL | Recombinant Human SPRYD7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRYD7 Products
Required fields are marked with *
My Review for All SPRYD7 Products
Required fields are marked with *