Recombinant Human SPRYD7 Protein, GST-tagged

Cat.No. : SPRYD7-519H
Product Overview : Human C13orf1 full-length ORF ( AAH22519.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.01 kDa
AA Sequence : MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYDDDSAILDCQFSEFYHTPPPGFEKILFEQQIF
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SPRYD7 SPRY domain containing 7 [ Homo sapiens (human) ]
Official Symbol SPRYD7
Synonyms CLLD6; C13orf1
Gene ID 57213
UniProt ID Q5W111.2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRYD7 Products

Required fields are marked with *

My Review for All SPRYD7 Products

Required fields are marked with *

0
cart-icon
0
compare icon