Recombinant Full Length Human SPX Protein, GST-tagged
| Cat.No. : | SPX-2026HF |
| Product Overview : | Human SPX full-length ORF (BAG51298.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 116 amino acids |
| Description : | The protein encoded by this gene is a hormone involved in modulation of cardiovascular and renal function. It has also been shown in rats to cause weight loss. Several transcript variants have been found for this gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 39.7 kDa |
| AA Sequence : | MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SPX spexin hormone [ Homo sapiens (human) ] |
| Official Symbol | C12orf39 |
| Synonyms | C12orf39 |
| Gene ID | 80763 |
| mRNA Refseq | NM_030572.2 |
| Protein Refseq | NP_085049.1 |
| MIM | 619246 |
| UniProt ID | Q9BT56 |
| ◆ Recombinant Proteins | ||
| SPX-2026HF | Recombinant Full Length Human SPX Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPX Products
Required fields are marked with *
My Review for All SPX Products
Required fields are marked with *
Recently Viewed
