Recombinant Full Length Human SRGN Protein
Cat.No. : | SRGN-494HF |
Product Overview : | Recombinant full length Human SRGN with N terminal proprietary tag; Predicted MW 43.49 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 43.490kDa inclusive of tags |
Protein Length : | 158 amino acids |
AA Sequence : | MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRC NPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRI QDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY QLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | SRGN serglycin [ Homo sapiens ] |
Official Symbol : | SRGN |
Synonyms : | SRGN; serglycin; PRG, PRG1, proteoglycan 1, secretory granule; PPG; serglycin proteoglycan |
Gene ID : | 5552 |
mRNA Refseq : | NM_002727 |
Protein Refseq : | NP_002718 |
MIM : | 177040 |
UniProt ID : | P10124 |
Products Types
◆ Recombinant Protein | ||
Srgn-2104R | Recombinant Rat Srgn Protein, His&GST-tagged | +Inquiry |
SRGN-8716M | Recombinant Mouse SRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
SRGN-2624H | Recombinant Human SRGN protein(81-150 aa), C-His-tagged | +Inquiry |
SRGN-2734H | Recombinant Human SRGN Protein, His-tagged | +Inquiry |
SRGN-4280R | Recombinant Rhesus Macaque SRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
SRGN-1119HCL | Recombinant Human SRGN cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket