Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human SRGN Protein

Cat.No. : SRGN-494HF
Product Overview : Recombinant full length Human SRGN with N terminal proprietary tag; Predicted MW 43.49 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 43.490kDa inclusive of tags
Protein Length : 158 amino acids
AA Sequence : MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRC NPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRI QDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY QLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : SRGN serglycin [ Homo sapiens ]
Official Symbol : SRGN
Synonyms : SRGN; serglycin; PRG, PRG1, proteoglycan 1, secretory granule; PPG; serglycin proteoglycan
Gene ID : 5552
mRNA Refseq : NM_002727
Protein Refseq : NP_002718
MIM : 177040
UniProt ID : P10124

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends