Recombinant Full Length Human SRGN Protein
| Cat.No. : | SRGN-494HF |
| Product Overview : | Recombinant full length Human SRGN with N terminal proprietary tag; Predicted MW 43.49 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 158 amino acids |
| Description : | This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 43.490kDa inclusive of tags |
| AA Sequence : | MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRC NPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRI QDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY QLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | SRGN serglycin [ Homo sapiens ] |
| Official Symbol | SRGN |
| Synonyms | SRGN; serglycin; PRG, PRG1, proteoglycan 1, secretory granule; PPG; serglycin proteoglycan |
| Gene ID | 5552 |
| mRNA Refseq | NM_002727 |
| Protein Refseq | NP_002718 |
| MIM | 177040 |
| UniProt ID | P10124 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRGN Products
Required fields are marked with *
My Review for All SRGN Products
Required fields are marked with *
