Recombinant Full Length Human SRM Protein, C-Flag-tagged
| Cat.No. : | SRM-1642HFL |
| Product Overview : | Recombinant Full Length Human SRM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The polyamines putrescine, spermine, and spermidine are ubiquitous polycationic mediators of cell growth and differentiation. Spermidine synthase is one of four enzymes in the polyamine-biosynthetic pathway and carries out the final step of spermidine biosynthesis. This enzyme catalyzes the conversion of putrescine to spermidine using decarboxylated S-adenosylmethionine as the cofactor. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 33.6 kDa |
| AA Sequence : | MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQ CTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGM AIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQ WLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYN SDVHRAAFVLPEFARKALNDVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Pathways : | Arginine and proline metabolism, beta-Alanine metabolism, Cysteine and methionine metabolism, Glutathione metabolism, Metabolic pathways |
| Full Length : | Full L. |
| Gene Name | SRM spermidine synthase [ Homo sapiens (human) ] |
| Official Symbol | SRM |
| Synonyms | PAPT; SPS1; SPDSY; SRML1 |
| Gene ID | 6723 |
| mRNA Refseq | NM_003132.3 |
| Protein Refseq | NP_003123.2 |
| MIM | 182891 |
| UniProt ID | P19623 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRM Products
Required fields are marked with *
My Review for All SRM Products
Required fields are marked with *
