Recombinant Full Length Human SRM Protein, C-Flag-tagged
Cat.No. : | SRM-1642HFL |
Product Overview : | Recombinant Full Length Human SRM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The polyamines putrescine, spermine, and spermidine are ubiquitous polycationic mediators of cell growth and differentiation. Spermidine synthase is one of four enzymes in the polyamine-biosynthetic pathway and carries out the final step of spermidine biosynthesis. This enzyme catalyzes the conversion of putrescine to spermidine using decarboxylated S-adenosylmethionine as the cofactor. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.6 kDa |
AA Sequence : | MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQ CTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGM AIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQ WLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYN SDVHRAAFVLPEFARKALNDVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Arginine and proline metabolism, beta-Alanine metabolism, Cysteine and methionine metabolism, Glutathione metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | SRM spermidine synthase [ Homo sapiens (human) ] |
Official Symbol | SRM |
Synonyms | PAPT; SPS1; SPDSY; SRML1 |
Gene ID | 6723 |
mRNA Refseq | NM_003132.3 |
Protein Refseq | NP_003123.2 |
MIM | 182891 |
UniProt ID | P19623 |
◆ Recombinant Proteins | ||
SRM-11266Z | Recombinant Zebrafish SRM | +Inquiry |
SRM-2954H | Recombinant Human SRM, GST-tagged | +Inquiry |
SRM-4282R | Recombinant Rhesus Macaque SRM Protein, His (Fc)-Avi-tagged | +Inquiry |
SRM-805H | Recombinant Human Spermidine Synthase, His-tagged | +Inquiry |
SRM-4466R | Recombinant Rhesus monkey SRM Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRM-1479HCL | Recombinant Human SRM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRM Products
Required fields are marked with *
My Review for All SRM Products
Required fields are marked with *
0
Inquiry Basket