Recombinant Full Length Human SRP14 Protein, C-Flag-tagged

• Cat.No.: SRP14-2111HFL
• Product Overview: Recombinant Full Length Human SRP14 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables RNA binding activity. Involved in protein targeting to ER. Located in nucleus. Part of signal recognition particle, endoplasmic reticulum targeting.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 14.4 kDa
• AA Sequence: MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Protein export
• Full Length: Full L.

Gene Information

• Gene Name: SRP14 signal recognition particle 14 [ Homo sapiens (human) ]
• Official Symbol: SRP14
• Synonyms: ALURBP
• Gene ID: 6727
• mRNA Refseq: NM_003134.6
• Protein Refseq: NP_003125.3
• MIM: 600708
• UniProt ID: P37108