Recombinant Full Length Human SRP14 Protein, C-Flag-tagged
| Cat.No. : | SRP14-2111HFL |
| Product Overview : | Recombinant Full Length Human SRP14 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables RNA binding activity. Involved in protein targeting to ER. Located in nucleus. Part of signal recognition particle, endoplasmic reticulum targeting. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 14.4 kDa |
| AA Sequence : | MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Pathways : | Protein export |
| Full Length : | Full L. |
| Gene Name | SRP14 signal recognition particle 14 [ Homo sapiens (human) ] |
| Official Symbol | SRP14 |
| Synonyms | ALURBP |
| Gene ID | 6727 |
| mRNA Refseq | NM_003134.6 |
| Protein Refseq | NP_003125.3 |
| MIM | 600708 |
| UniProt ID | P37108 |
| ◆ Recombinant Proteins | ||
| SRP14-3416Z | Recombinant Zebrafish SRP14 | +Inquiry |
| SRP14-719C | Recombinant Cynomolgus Monkey SRP14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SRP14-4283R | Recombinant Rhesus Macaque SRP14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SRP14-5192H | Recombinant Human SRP14 protein, GST-tagged | +Inquiry |
| SRP14-2955H | Recombinant Human SRP14, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRP14 Products
Required fields are marked with *
My Review for All SRP14 Products
Required fields are marked with *
