Recombinant Full Length Human SRP14 Protein, C-Flag-tagged

Cat.No. : SRP14-2111HFL
Product Overview : Recombinant Full Length Human SRP14 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables RNA binding activity. Involved in protein targeting to ER. Located in nucleus. Part of signal recognition particle, endoplasmic reticulum targeting.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 14.4 kDa
AA Sequence : MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Protein export
Full Length : Full L.
Gene Name SRP14 signal recognition particle 14 [ Homo sapiens (human) ]
Official Symbol SRP14
Synonyms ALURBP
Gene ID 6727
mRNA Refseq NM_003134.6
Protein Refseq NP_003125.3
MIM 600708
UniProt ID P37108

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRP14 Products

Required fields are marked with *

My Review for All SRP14 Products

Required fields are marked with *

0
cart-icon