Recombinant Full Length Human SRSF1 Protein, C-Flag-tagged

• Cat.No.: SRSF1-433HFL
• Product Overview: Recombinant Full Length Human SRSF1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 27.6 kDa
• AA Sequence: MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
  SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome
• Full Length: Full L.

Gene Information

• Gene Name: SRSF1 serine and arginine rich splicing factor 1 [ Homo sapiens (human) ]
• Official Symbol: SRSF1
• Synonyms: ASF; SF2; SFRS1; SF2p33; SRp30a
• Gene ID: 6426
• mRNA Refseq: NM_006924.5
• Protein Refseq: NP_008855.1
• MIM: 600812
• UniProt ID: Q07955