Recombinant Full Length Human SSBP1 Protein

• Cat.No.: SSBP1-498HF
• Product Overview: Recombinant full length Human SSBP1 with proprietary tag; Predicted MWt 41.69 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 148 amino acids
• Description: SSBP1 is a housekeeping gene involved in mitochondrial biogenesis.
• Form: Liquid
• Molecular Mass: 41.690kDa inclusive of tags
• AA Sequence: MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: SSBP1 single-stranded DNA binding protein 1 [ Homo sapiens ]
• Official Symbol: SSBP1
• Synonyms: SSBP1; single-stranded DNA binding protein 1; single stranded DNA binding protein; single-stranded DNA-binding protein, mitochondrial; SSBP
• Gene ID: 6742
• mRNA Refseq: NM_003143
• Protein Refseq: NP_003134
• MIM: 600439
• UniProt ID: Q04837