Recombinant Human SSBP1
Cat.No. : | SSBP1-29275TH |
Product Overview : | Recombinant full length Human SSBP1 with proprietary tag; Predicted MWt 41.69 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 148 amino acids |
Description : | SSBP1 is a housekeeping gene involved in mitochondrial biogenesis (Tiranti et al. |
Molecular Weight : | 41.690kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE |
Sequence Similarities : | Contains 1 SSB domain. |
Gene Name | SSBP1 single-stranded DNA binding protein 1 [ Homo sapiens ] |
Official Symbol | SSBP1 |
Synonyms | SSBP1; single-stranded DNA binding protein 1; single stranded DNA binding protein; single-stranded DNA-binding protein, mitochondrial; SSBP; |
Gene ID | 6742 |
mRNA Refseq | NM_003143 |
Protein Refseq | NP_003134 |
MIM | 600439 |
Uniprot ID | Q04837 |
Chromosome Location | 7q34 |
Pathway | DNA replication, organism-specific biosystem; DNA replication, conserved biosystem; Homologous recombination, organism-specific biosystem; Homologous recombination, conserved biosystem; Mismatch repair, organism-specific biosystem; |
Function | DNA binding; chromatin binding; single-stranded DNA binding; |
◆ Recombinant Proteins | ||
SSBP1-2539Z | Recombinant Zebrafish SSBP1 | +Inquiry |
SSBP1-29275TH | Recombinant Human SSBP1 | +Inquiry |
SSBP1-5411R | Recombinant Rat SSBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSBP1-16023M | Recombinant Mouse SSBP1 Protein | +Inquiry |
SSBP1-4298R | Recombinant Rhesus Macaque SSBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSBP1-1465HCL | Recombinant Human SSBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSBP1 Products
Required fields are marked with *
My Review for All SSBP1 Products
Required fields are marked with *