Recombinant Full Length Human SSNA1 Protein, C-Flag-tagged

Cat.No. : SSNA1-1635HFL
Product Overview : Recombinant Full Length Human SSNA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables identical protein binding activity. Predicted to act upstream of or within ciliary receptor clustering involved in smoothened signaling pathway and intraciliary transport. Located in centrosome.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 13.4 kDa
AA Sequence : MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name SSNA1 SS nuclear autoantigen 1 [ Homo sapiens (human) ]
Official Symbol SSNA1
Synonyms N14; NA14; NA-14
Gene ID 8636
mRNA Refseq NM_003731.3
Protein Refseq NP_003722.2
MIM 610882
UniProt ID O43805

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SSNA1 Products

Required fields are marked with *

My Review for All SSNA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon