Recombinant Full Length Human SSNA1 Protein, C-Flag-tagged
| Cat.No. : | SSNA1-1635HFL |
| Product Overview : | Recombinant Full Length Human SSNA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables identical protein binding activity. Predicted to act upstream of or within ciliary receptor clustering involved in smoothened signaling pathway and intraciliary transport. Located in centrosome. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 13.4 kDa |
| AA Sequence : | MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | SSNA1 SS nuclear autoantigen 1 [ Homo sapiens (human) ] |
| Official Symbol | SSNA1 |
| Synonyms | N14; NA14; NA-14 |
| Gene ID | 8636 |
| mRNA Refseq | NM_003731.3 |
| Protein Refseq | NP_003722.2 |
| MIM | 610882 |
| UniProt ID | O43805 |
| ◆ Recombinant Proteins | ||
| SSNA1-5989H | Recombinant Human SSNA1 protein, GST-tagged | +Inquiry |
| SSNA1-2860H | Recombinant Human SSNA1 Protein, MYC/DDK-tagged | +Inquiry |
| SSNA1-2105H | Recombinant Human SSNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ssna1-6144M | Recombinant Mouse Ssna1 Protein, Myc/DDK-tagged | +Inquiry |
| SSNA1-1635HFL | Recombinant Full Length Human SSNA1 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SSNA1-1696HCL | Recombinant Human SSNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSNA1 Products
Required fields are marked with *
My Review for All SSNA1 Products
Required fields are marked with *
