| Species : |
Human |
| Source : |
HEK293T |
| Tag : |
Flag |
| Protein Length : |
1-370 aa |
| Description : |
Predicted to enable molecular carrier activity. Predicted to be involved in ubiquinone biosynthetic process. Predicted to act upstream of or within several processes, including establishment of skin barrier; mucociliary clearance; and myeloid dendritic cell activation. Located in mitochondrion. Implicated in familial adult myoclonic epilepsy 2. |
| Form : |
25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Molecular Mass : |
42.9 kDa |
| AASequence : |
MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPARIEYATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : |
> 80% as determined by SDS-PAGE and Coomassie blue staining |
| Notes : |
For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage : |
Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Concentration : |
> 0.05 μg/μL as determined by microplate BCA method |