Recombinant Full Length Human STARD7 Protein, Flag tagged

• Cat.No.: STARD7-09HFL
• Product Overview: Recombinant protein of human StAR-related lipid transfer (START) domain containing 7 (STARD7) with Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: Flag
• Protein Length: 1-370 aa
• Description: Predicted to enable molecular carrier activity. Predicted to be involved in ubiquinone biosynthetic process. Predicted to act upstream of or within several processes, including establishment of skin barrier; mucociliary clearance; and myeloid dendritic cell activation. Located in mitochondrion. Implicated in familial adult myoclonic epilepsy 2.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 42.9 kDa
• AASequence: MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPARIEYATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: > 0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: STARD7 StAR related lipid transfer domain containing 7 [ Homo sapiens (human) ]
• Official Symbol: STARD7
• Synonyms: STARD7; StAR related lipid transfer domain containing 7; FAME; GTT1; ADCME; FAME2; BAFME2; FCMTE2
• Gene ID: 56910
• mRNA Refseq: NM_020151
• Protein Refseq: NP_064536
• MIM: 616712
• UniProt ID: Q9NQZ5