Recombinant Full Length Human STMN1 Protein, C-Flag-tagged

Cat.No. : STMN1-1907HFL
Product Overview : Recombinant Full Length Human STMN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 17.1 kDa
AA Sequence : MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLK QLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESK DPADETEAD myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : MAPK signaling pathway
Full Length : Full L.
Gene Name STMN1 stathmin 1 [ Homo sapiens (human) ]
Official Symbol STMN1
Synonyms Lag; SMN; OP18; PP17; PP19; PR22; LAP18; C1orf215
Gene ID 3925
mRNA Refseq NM_203399.2
Protein Refseq NP_981944.1
MIM 151442
UniProt ID P16949

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STMN1 Products

Required fields are marked with *

My Review for All STMN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon