Recombinant Full Length Human STS Protein, C-Flag-tagged
Cat.No. : | STS-1272HFL |
Product Overview : | Recombinant Full Length Human STS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a multi-pass membrane protein that is localized to the endoplasmic reticulum. It belongs to the sulfatase family and hydrolyzes several 3-beta-hydroxysteroid sulfates, which serve as metabolic precursors for estrogens, androgens, and cholesterol. Mutations in this gene are associated with X-linked ichthyosis (XLI). Alternatively spliced transcript variants resulting from the use of different promoters have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 62.9 kDa |
AA Sequence : | MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLA ASPLCTPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGMS CHSKTDFCHHPLHHGFNYFYGISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLAALNCLGLLH VPLGVFFSLLFLAALILTLFLGFLHYFRPLNCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPF LLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEV SSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRI IDGRDLMPLLEGKSQRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFATHVCFCF GSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQ LCCPSTGLSCQCDREKQDKRLSRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Androgen and estrogen metabolism |
Full Length : | Full L. |
Gene Name | STS steroid sulfatase [ Homo sapiens (human) ] |
Official Symbol | STS |
Synonyms | ES; ASC; XLI; ARSC; SSDD; ARSC1 |
Gene ID | 412 |
mRNA Refseq | NM_000351.7 |
Protein Refseq | NP_000342.3 |
MIM | 300747 |
UniProt ID | P08842 |
◆ Recombinant Proteins | ||
RFL27998HF | Recombinant Full Length Human Steryl-Sulfatase(Sts) Protein, His-Tagged | +Inquiry |
STS-511HF | Recombinant Full Length Human STS Protein, GST-tagged | +Inquiry |
STS-210H | Recombinant Human STS, GST-tagged | +Inquiry |
STS-5466R | Recombinant Rat STS Protein, His (Fc)-Avi-tagged | +Inquiry |
STS-1272HFL | Recombinant Full Length Human STS Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STS-1383HCL | Recombinant Human STS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STS Products
Required fields are marked with *
My Review for All STS Products
Required fields are marked with *
0
Inquiry Basket