Recombinant Full Length Human STX5 Protein, C-Flag-tagged
Cat.No. : | STX5-1076HFL |
Product Overview : | Recombinant Full Length Human STX5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for v-SNAREs (vesicle-SNAP receptors), permitting specific synaptic vesicle docking and fusion. The encoded protein regulates endoplasmic reticulum to Golgi transport and plays a critical role in autophagy. Autoantibodies targeting the encoded protein may be a diagnostic marker for endometriosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.5 kDa |
AA Sequence : | MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDRTQEFLSACKS LQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIK QDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQRSRREQ FSRAPVSALPLAPNHLGGGAVVLGAESHASKDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTI VELGSIFQQLAHMVKEQEETIQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIF VVFLATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | SNARE interactions in vesicular transport |
Full Length : | Full L. |
Gene Name | STX5 syntaxin 5 [ Homo sapiens (human) ] |
Official Symbol | STX5 |
Synonyms | SED5; STX5A |
Gene ID | 6811 |
mRNA Refseq | NM_003164.5 |
Protein Refseq | NP_003155.2 |
MIM | 603189 |
UniProt ID | Q13190 |
◆ Recombinant Proteins | ||
STX5-5474R | Recombinant Rat STX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
STX5-2846H | Recombinant Human STX5 protein(221-330 aa), C-His-tagged | +Inquiry |
STX5-2524H | Recombinant Human STX5 protein, His-tagged | +Inquiry |
STX5-1076HFL | Recombinant Full Length Human STX5 Protein, C-Flag-tagged | +Inquiry |
STX5-5815R | Recombinant Rat STX5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STX5-1374HCL | Recombinant Human STX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STX5 Products
Required fields are marked with *
My Review for All STX5 Products
Required fields are marked with *
0
Inquiry Basket