Recombinant Full Length Human T-Cell Surface Glycoprotein Cd3 Epsilon Chain(Cd3E) Protein, His-Tagged
Cat.No. : | RFL22526HF |
Product Overview : | Recombinant Full Length Human T-cell surface glycoprotein CD3 epsilon chain(CD3E) Protein (P07766) (23-207aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-207) |
Form : | Lyophilized powder |
AA Sequence : | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD3E |
Synonyms | CD3 epsilon; CD3e; CD3e antigen; CD3e antigen epsilon polypeptide (TiT3 complex); CD3E antigen epsilon polypeptide; CD3E antigen, epsilon subunit; CD3e molecule epsilon; CD3e molecule, epsilon (CD3 TCR complex); CD3e molecule, epsilon (CD3-TCR complex); C |
UniProt ID | P07766 |
◆ Recombinant Proteins | ||
CD3E-2195H | Recombinant Human CD3E protein, Strep-tagged | +Inquiry |
CD3E-138H | Recombinant Human CD3E Protein, His-tagged, Biotinylated | +Inquiry |
CD3E-30H | Recombinant Human CD3E Protein (198 AA), C-Fc-tagged | +Inquiry |
CD3E & CD3G-3257M | Recombinant Mouse CD3E & CD3G protein(Met1-Asp108 & Met1-Ser116), hFc&His&hFc-tagged | +Inquiry |
CD3E-3174HF | Recombinant Full Length Human CD3E Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *
0
Inquiry Basket