Recombinant Full Length Human T-Cell Surface Glycoprotein Cd3 Epsilon Chain(Cd3E) Protein, His-Tagged
| Cat.No. : | RFL22526HF |
| Product Overview : | Recombinant Full Length Human T-cell surface glycoprotein CD3 epsilon chain(CD3E) Protein (P07766) (23-207aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (23-207) |
| Form : | Lyophilized powder |
| AA Sequence : | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CD3E |
| Synonyms | CD3 epsilon; CD3e; CD3e antigen; CD3e antigen epsilon polypeptide (TiT3 complex); CD3E antigen epsilon polypeptide; CD3E antigen, epsilon subunit; CD3e molecule epsilon; CD3e molecule, epsilon (CD3 TCR complex); CD3e molecule, epsilon (CD3-TCR complex); C |
| UniProt ID | P07766 |
| ◆ Recombinant Proteins | ||
| CD3E-3723H | Recombinant Human CD3E protein, rFc-tagged | +Inquiry |
| CD3E & CD3G-1970R | Recombinant Rhesus CD3E & CD3G protein, hFc-tagged | +Inquiry |
| CD3E-213HAF488 | Recombinant Human CD3E protein, His-tagged, Alexa Fluor 488-Labelled | +Inquiry |
| CD3E & CD3G-251H | Active Recombinant Human CD3E & CD3G protein, Flag & mFc-tagged | +Inquiry |
| CD3E-321H | Recombinant Human CD3E Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD3E-1275HCL | Recombinant Human CD3E cell lysate | +Inquiry |
| CD3E-1602CCL | Recombinant Cynomolgus CD3E cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD3E Products
Required fields are marked with *
My Review for All CD3E Products
Required fields are marked with *
