Recombinant Full Length Human TCP1 Protein, C-Flag-tagged
Cat.No. : | TCP1-1996HFL |
Product Overview : | Recombinant Full Length Human TCP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 60.2 kDa |
AA Sequence : | MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHP AAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNT DELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESML ISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILA TGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEE VVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALS IYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDL SNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHSGALND myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TCP1 t-complex 1 [ Homo sapiens (human) ] |
Official Symbol | TCP1 |
Synonyms | CCT-alpha, CCT1, CCTa, D6S230E, TCP-1-alpha |
Gene ID | 6950 |
mRNA Refseq | NM_030752.3 |
Protein Refseq | NP_110379.2 |
MIM | 186980 |
UniProt ID | P17987 |
◆ Recombinant Proteins | ||
TCP1-752C | Recombinant Cynomolgus Monkey TCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TCP1-1009C | Recombinant Cynomolgus TCP1 Protein, His-tagged | +Inquiry |
TCP1-1547C | Recombinant Chicken TCP1 | +Inquiry |
TCP1-2120H | Recombinant Human TCP1 Protein, His&GST-tagged | +Inquiry |
TCP1-9090M | Recombinant Mouse TCP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCP1-1169HCL | Recombinant Human TCP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCP1 Products
Required fields are marked with *
My Review for All TCP1 Products
Required fields are marked with *
0
Inquiry Basket