Recombinant Full Length Human Tetraspanin-31(Tspan31) Protein, His-Tagged
Cat.No. : | RFL33249HF |
Product Overview : | Recombinant Full Length Human Tetraspanin-31(TSPAN31) Protein (Q12999) (1-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-210) |
Form : | Lyophilized powder |
AA Sequence : | MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIA VAGLVGAVNHHQVLLFFYMIILGLVFIFQFVISCSCLAINRSKQTDVINASWWVMSNKTR DELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGL FFSFTEILGVWLAMRFRNQKDPRANPSAFL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TSPAN31 |
Synonyms | TSPAN31; SAS; Tetraspanin-31; Tspan-31; Sarcoma-amplified sequence |
UniProt ID | Q12999 |
◆ Recombinant Proteins | ||
TSPAN31-2383H | Recombinant Human TSPAN31 protein(Cys94-Lys173), mFc-tagged | +Inquiry |
TSPAN31-17510M | Recombinant Mouse TSPAN31 Protein | +Inquiry |
RFL36341SF | Recombinant Full Length Pig Tetraspanin-31(Tspan31) Protein, His-Tagged | +Inquiry |
RFL24296MF | Recombinant Full Length Mouse Tetraspanin-31(Tspan31) Protein, His-Tagged | +Inquiry |
RFL6509DF | Recombinant Full Length Danio Rerio Tetraspanin-31(Tspan31) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPAN31-780HCL | Recombinant Human TSPAN31 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSPAN31 Products
Required fields are marked with *
My Review for All TSPAN31 Products
Required fields are marked with *