Recombinant Full Length Human TIMD4 Protein, C-Flag-tagged
Cat.No. : | TIMD4-2137HFL |
Product Overview : | Recombinant Full Length Human TIMD4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable phosphatidylserine binding activity. Predicted to act upstream of or within apoptotic cell clearance. Predicted to be integral component of membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.4 kDa |
AA Sequence : | MSKEPLILWLMIEFWWLYLTPVTSETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIR TDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLNLQRASTTTHR TATTTTRRTTTTSPTTTRQMTTTPAALPTTVVTTPDLTTGTPLQMTTIAVFTTANTCLSLTPSTLPEEAT GLLTPEPSKEGPILTAESETVLPSDSWSSAESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQP GASDTAVPEQNKTTKTGQMDGIPMSMKNEMPISQLLMIIAPSLGFVLFALFVAFLLRGKLMETYCSQKHT RLDYIGDSKNVLNDVQHGREDEDGLFTL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | TIMD4 T cell immunoglobulin and mucin domain containing 4 [ Homo sapiens (human) ] |
Official Symbol | TIMD4 |
Synonyms | TIM4; SMUCKLER |
Gene ID | 91937 |
mRNA Refseq | NM_138379.3 |
Protein Refseq | NP_612388.2 |
MIM | 610096 |
UniProt ID | Q96H15 |
◆ Recombinant Proteins | ||
TIMD4-1030H | Recombinant Human TIMD4 Protein, MYC/DDK-tagged | +Inquiry |
TIMD4-3954H | Recombinant Human TIMD4 protein(Met1-Leu315), His-tagged | +Inquiry |
TIMD4-3294H | Recombinant Human TIMD4 protein(Met 1-Leu 315), His-tagged, Biotinylated | +Inquiry |
TIMD4-616M | Active Recombinant Mouse Timd4, MIgG2a Fc-tagged | +Inquiry |
TIMD4-1550C | Recombinant Cynomolgus TIMD4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIMD4-1897HCL | Recombinant Human TIMD4 cell lysate | +Inquiry |
TIMD4-2465MCL | Recombinant Mouse TIMD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIMD4 Products
Required fields are marked with *
My Review for All TIMD4 Products
Required fields are marked with *
0
Inquiry Basket