Recombinant Full Length Human TIMM13 Protein, Flag tagged

• Cat.No.: TIMM13-12HFL
• Product Overview: Recombinant protein of human translocase of inner mitochondrial membrane 13 homolog (yeast) (TIMM13), nuclear gene encoding mitochondrial protein with C-Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: Flag
• Protein Length: 1-95 aa
• Description: This gene encodes a member of the evolutionarily conserved TIMM (translocase of inner mitochondrial membrane) family of proteins that function as chaperones in the import of proteins from the cytoplasm into the mitochondrial inner membrane. Proteins of this family play a role in collecting substrate proteins from the translocase of the outer mitochondrial membrane (TOM) complex and delivering them to either the sorting and assembly machinery in the outer mitochondrial membrane (SAM) complex or the TIMM22 complex in the inner mitochondrial membrane. The encoded protein and the translocase of mitochondrial inner membrane 8a protein form a 70 kDa complex in the intermembrane space.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 10.3 kDa
• AASequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: >0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: TIMM13 translocase of inner mitochondrial membrane 13 homolog (yeast) [ Homo sapiens (human) ]
• Official Symbol: TIMM13
• Synonyms: TIMM13; translocase of inner mitochondrial membrane 13 homolog (yeast); TIMM13B, translocase of inner mitochondrial membrane 13 (yeast) homolog B; mitochondrial import inner membrane translocase subunit Tim13; Tim13; mitochondrial import inner membrane translocase subunit Tim13B; ppv1; TIM13; TIM13B; TIMM13A; TIMM13B
• Gene ID: 26517
• mRNA Refseq: NM_012458
• Protein Refseq: NP_036590
• MIM: 607383
• UniProt ID: Q9Y5L4