Recombinant Full Length Human TLK1 Protein, C-Flag-tagged
Cat.No. : | TLK1-1453HFL |
Product Overview : | Recombinant Full Length Human TLK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a serine/threonine kinase that may be involved in the regulation of chromatin assembly. The encoded protein is only active when it is phosphorylated, and this phosphorylation is cell cycle-dependent, with the maximal activity of this protein coming during S phase. The catalytic activity of this protein is diminished by DNA damage and by blockage of DNA replication. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 86.5 kDa |
AA Sequence : | MSVQSSSGSLEGPPSWSQLSTSPTPGSAAAARSLLNHTPPSGRPREGAMDELHSLDPRRQELLEARFTGV ASGSTGSTGSCSVGAKASTNNESSNHSFGSLGSLSDKESETPEKKQSESSRGRKRKAENQNESSQGKSIG GRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFK IIQTDLTMLKLAALESNKIQDLEKKEGRIDDLLRANCDLRRQIDEQQKLLEKYKERLNKCISMSKKLLIE KSTQEKLSSREKSMQDRLRLGHFTTVRHGASFTEQWTDGFAFQNLVKQQEWVNQQREDIERQRKLLAKRK PPTANNSQAPSTNSEPKQRKNKAVNGAENDPFVRPNLPQLLTLAEYHEQEEIFKLRLGHLKKEEAEIQAE LERLERVRNLHIRELKRINNEDNSQFKDHPTLNERYLLLHLLGRGGFSEVYKAFDLYEQRYAAVKIHQLN KSWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDTFCTVLEYCEGNDLDFYLKQHKLMSEKE ARSIVMQIVNALRYLNEIKPPIIHYDLKPGNILLVDGTACGEIKITDFGLSKIMDDDSYGVDGMDLTSQG AGTYWYLPPECFVVGKEPPKISNKVDVWSVGVIFFQCLYGRKPFGHNQSQQDILQENTILKATEVQFPVK PVVSSEAKAFIRRCLAYRKEDRFDVHQLANDPYLLPHMRRSNSSGNLHMAGLTASPTPPSSSIITYSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Full Length : | Full L. |
Gene Name | TLK1 tousled like kinase 1 [ Homo sapiens (human) ] |
Official Symbol | TLK1 |
Synonyms | PKU-beta |
Gene ID | 9874 |
mRNA Refseq | NM_012290.5 |
Protein Refseq | NP_036422.3 |
MIM | 608438 |
UniProt ID | Q9UKI8 |
◆ Recombinant Proteins | ||
TLK1-1497H | Active Recombinant Human TLK1, GST-tagged | +Inquiry |
TLK1-2202H | Recombinant Human TLK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TLK1-1107H | Recombinant Human TLK1 Protein, MYC/DDK-tagged | +Inquiry |
TLK1-5620HF | Active Recombinant Full Length Human TLK1 Protein, GST-tagged | +Inquiry |
TLK1-901H | Recombinant Human TLK1 protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLK1-589HCL | Recombinant Human TLK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLK1 Products
Required fields are marked with *
My Review for All TLK1 Products
Required fields are marked with *
0
Inquiry Basket