Recombinant Full Length Human TMEM138 Protein, GST-tagged

Cat.No. : TMEM138-5660HF
Product Overview : Human HSPC196 full-length ORF ( AAH05201, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 162 amino acids
Description : This gene encodes a multi-pass transmembrane protein. Reduced expression of this gene in mouse fibroblasts causes short cilia and failure of ciliogenesis. Expression of this gene is tightly coordinated with expression of the neighboring gene TMEM216. Mutations in this gene are associated with the autosomal recessive neurodevelopmental disorder Joubert Syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012]
Molecular Mass : 43.56 kDa
AA Sequence : MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVLFNIIIIFLMFFNTFVFQAGLVNLLFHKFKGTIILTAVYFALSISLHVWVMNLRWKNSNSFIWTDGLQMLFVFQRLAAVLYCYFYKRTAVRLGDPHFYQDSLWLRKEFMQVRR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TMEM138 transmembrane protein 138 [ Homo sapiens ]
Official Symbol TMEM138
Synonyms TMEM138; transmembrane protein 138; HSPC196;
Gene ID 51524
mRNA Refseq NM_016464
Protein Refseq NP_057548
MIM 614459
UniProt ID Q9NPI0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMEM138 Products

Required fields are marked with *

My Review for All TMEM138 Products

Required fields are marked with *

0
cart-icon
0
compare icon