Recombinant Full Length Human TMEM208 Protein, GST-tagged
Cat.No. : | TMEM208-5658HF |
Product Overview : | Human HSPC171 full-length ORF ( AAH13412.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 173 amino acids |
Description : | This gene encodes a highly conserved protein which is localized in the endoplasmic reticulum (ER). The protein is linked to autophagy and ER stress. Knockdown of this gene increased autophagy and triggered ER stress. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 46.1 kDa |
AA Sequence : | MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHSMSSMARAAFSEYGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TMEM208 transmembrane protein 208 [ Homo sapiens ] |
Official Symbol | TMEM208 |
Synonyms | HSPC171; TMEM208; transmembrane protein 208 |
Gene ID | 29100 |
mRNA Refseq | NM_014187 |
Protein Refseq | NP_054906 |
UniProt ID | Q9BTX3 |
◆ Recombinant Proteins | ||
RFL10081MF | Recombinant Full Length Mouse Transmembrane Protein 208(Tmem208) Protein, His-Tagged | +Inquiry |
TMEM208-4805R | Recombinant Rhesus monkey TMEM208 Protein, His-tagged | +Inquiry |
RFL14938HF | Recombinant Full Length Human Transmembrane Protein 208(Tmem208) Protein, His-Tagged | +Inquiry |
TMEM208-5266H | Recombinant Human TMEM208 Protein, GST-tagged | +Inquiry |
TMEM208-4594C | Recombinant Chicken TMEM208 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM208-967HCL | Recombinant Human TMEM208 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM208 Products
Required fields are marked with *
My Review for All TMEM208 Products
Required fields are marked with *
0
Inquiry Basket