Recombinant Full Length Human TMEM8B Protein, GST-tagged
Cat.No. : | TMEM8B-3546HF |
Product Overview : | Human C9orf127 full-length ORF (AAH41377.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 257 amino acids |
Description : | TMEM8B (Transmembrane Protein 8B) is a Protein Coding gene. Diseases associated with TMEM8B include Nasopharyngeal Carcinoma and Pharynx Cancer. An important paralog of this gene is TMEM8A. |
Molecular Mass : | 54.7 kDa |
AA Sequence : | MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TMEM8B transmembrane protein 8B [ Homo sapiens ] |
Official Symbol | TMEM8B |
Synonyms | TMEM8B; transmembrane protein 8B; C9orf127, chromosome 9 open reading frame 127; NAG 5; nasopharyngeal carcinoma expressed 6; NGX6; Protein NGX6; protein NAG-5; nasopharyngeal carcinoma related protein; nasopharyngeal carcinoma-associated gene 6 protein; NAG-5; C9orf127; RP11-112J3.10; MGC120460; |
Gene ID | 51754 |
mRNA Refseq | NM_001042589 |
Protein Refseq | NP_001036054 |
MIM | 616888 |
UniProt ID | A6NDV4 |
◆ Recombinant Proteins | ||
TMEM8B-17091M | Recombinant Mouse TMEM8B Protein | +Inquiry |
TMEM8B-3546HF | Recombinant Full Length Human TMEM8B Protein, GST-tagged | +Inquiry |
TMEM8B-9435M | Recombinant Mouse TMEM8B Protein, His (Fc)-Avi-tagged | +Inquiry |
TMEM8B-0185H | Recombinant Human TMEM8B Protein, GST-Tagged | +Inquiry |
RFL35195BF | Recombinant Full Length Bovine Transmembrane Protein 8B(Tmem8B) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM8B-260HCL | Recombinant Human TMEM8B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM8B Products
Required fields are marked with *
My Review for All TMEM8B Products
Required fields are marked with *