Recombinant Full Length Human TMSB4X Protein

• Cat.No.: TMSB4X-525HF
• Product Overview: Recombinant full length Human Thymosin beta 4 with a proprietary tag; predicted mwt: 30.84 kDa.

Specification

• Description: This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 30.840kDa inclusive of tags
• Protein Length: 44 amino acids
• AA Sequence: MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: TMSB4X thymosin beta 4, X-linked [ Homo sapiens ]
• Official Symbol: TMSB4X
• Synonyms: TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X
• Gene ID: 7114
• mRNA Refseq: NM_021109
• Protein Refseq: NP_066932
• MIM: 300159
• UniProt ID: P62328