Recombinant Full Length Human TMSB4X Protein
| Cat.No. : | TMSB4X-525HF |
| Product Overview : | Recombinant full length Human Thymosin beta 4 with a proprietary tag; predicted mwt: 30.84 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 44 amino acids |
| Description : | This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. |
| Form : | Liquid |
| Molecular Mass : | 30.840kDa inclusive of tags |
| AA Sequence : | MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | TMSB4X thymosin beta 4, X-linked [ Homo sapiens ] |
| Official Symbol | TMSB4X |
| Synonyms | TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X |
| Gene ID | 7114 |
| mRNA Refseq | NM_021109 |
| Protein Refseq | NP_066932 |
| MIM | 300159 |
| UniProt ID | P62328 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMSB4X Products
Required fields are marked with *
My Review for All TMSB4X Products
Required fields are marked with *
