Recombinant Full Length Human TMSB4X Protein
Cat.No. : | TMSB4X-525HF |
Product Overview : | Recombinant full length Human Thymosin beta 4 with a proprietary tag; predicted mwt: 30.84 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 44 amino acids |
Description : | This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. |
Form : | Liquid |
Molecular Mass : | 30.840kDa inclusive of tags |
AA Sequence : | MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | TMSB4X thymosin beta 4, X-linked [ Homo sapiens ] |
Official Symbol | TMSB4X |
Synonyms | TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X |
Gene ID | 7114 |
mRNA Refseq | NM_021109 |
Protein Refseq | NP_066932 |
MIM | 300159 |
UniProt ID | P62328 |
◆ Recombinant Proteins | ||
TMSB4X-051T | Recombinant Human TMSB4X Protein (43 aa) | +Inquiry |
TMSB4X-431H | Recombinant Human TMSB4X Protein, His-tagged | +Inquiry |
TMSB4X-6189R | Recombinant Rat TMSB4X Protein | +Inquiry |
Tmsb4x-7169M | Recombinant Mouse Tmsb4x protein, His-tagged | +Inquiry |
Tmsb4x-6531M | Recombinant Mouse Tmsb4x Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMSB4X-904HCL | Recombinant Human TMSB4X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMSB4X Products
Required fields are marked with *
My Review for All TMSB4X Products
Required fields are marked with *