Recombinant Full Length Human TMSB4X Protein

Cat.No. : TMSB4X-525HF
Product Overview : Recombinant full length Human Thymosin beta 4 with a proprietary tag; predicted mwt: 30.84 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 44 amino acids
Description : This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y.
Form : Liquid
Molecular Mass : 30.840kDa inclusive of tags
AA Sequence : MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name TMSB4X thymosin beta 4, X-linked [ Homo sapiens ]
Official Symbol TMSB4X
Synonyms TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X
Gene ID 7114
mRNA Refseq NM_021109
Protein Refseq NP_066932
MIM 300159
UniProt ID P62328

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TMSB4X Products

Required fields are marked with *

My Review for All TMSB4X Products

Required fields are marked with *

0
cart-icon