Recombinant Full Length Human TNFAIP3 Protein, C-Flag-tagged
| Cat.No. : | TNFAIP3-1013HFL |
| Product Overview : | Recombinant Full Length Human TNFAIP3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 89.4 kDa |
| AA Sequence : | MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALID RNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKF RWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVI SDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDR GRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQ HEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPK LNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQ HNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCH QRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIE YRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQ RRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHF GNAKCNGYCNECFQFKQMYGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Protein Pathways : | NOD-like receptor signaling pathway |
| Full Length : | Full L. |
| Gene Name | TNFAIP3 TNF alpha induced protein 3 [ Homo sapiens (human) ] |
| Official Symbol | TNFAIP3 |
| Synonyms | A20; AISBL; AIFBL1; OTUD7C; TNFA1P2 |
| Gene ID | 7128 |
| mRNA Refseq | NM_006290.4 |
| Protein Refseq | NP_006281.1 |
| MIM | 191163 |
| UniProt ID | P21580 |
| ◆ Recombinant Proteins | ||
| TNFAIP3-2154H | Recombinant Human TNFAIP3 Protein, GST-tagged | +Inquiry |
| TNFAIP3-2218H | Recombinant Human TNFAIP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TNFAIP3-1039C | Recombinant Cynomolgus TNFAIP3 Protein, His-tagged | +Inquiry |
| TNFAIP3-156H | Active Recombinant Human TNFAIP3, GST-tagged | +Inquiry |
| TNFAIP3-6192HF | Recombinant Full Length Human TNFAIP3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFAIP3 Products
Required fields are marked with *
My Review for All TNFAIP3 Products
Required fields are marked with *
