Recombinant Full Length Human TNFAIP3 Protein, GST-tagged

Cat.No. : TNFAIP3-6192HF
Product Overview : Human TNFAIP3 full-length ORF ( AAH98379.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 248 amino acids
Description : This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene.
Form : Liquid
Molecular Mass : 55.3 kDa
AA Sequence : MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISGEMPADHGSVLKCFQPYALAPGENHTAKVQVTEFNGI
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TNFAIP3 tumor necrosis factor, alpha-induced protein 3 [ Homo sapiens ]
Official Symbol TNFAIP3
Synonyms TNFAIP3; tumor necrosis factor, alpha-induced protein 3; tumor necrosis factor alpha-induced protein 3; A20; OTUD7C; TNFAIP3 (A20); zinc finger protein A20; TNF alpha-induced protein 3; OTU domain-containing protein 7C; putative DNA-binding protein A20; tumor necrosis factor inducible protein A20; TNFA1P2; MGC104522; MGC138687; MGC138688
Gene ID 7128
mRNA Refseq BC098379.1
Protein Refseq AAH98379.1
MIM 191163
UniProt ID P21580

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFAIP3 Products

Required fields are marked with *

My Review for All TNFAIP3 Products

Required fields are marked with *

0
cart-icon