Recombinant Full Length Human TNFSF18 Protein, C-Flag-tagged
| Cat.No. : | TNFSF18-1491HFL |
| Product Overview : | Recombinant Full Length Human TNFSF18 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 22.5 kDa |
| AA Sequence : | MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQ MASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTY ELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFISTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Transmembrane |
| Protein Pathways : | Cytokine-cytokine receptor interaction |
| Full Length : | Full L. |
| Gene Name | TNFSF18 TNF superfamily member 18 [ Homo sapiens (human) ] |
| Official Symbol | TNFSF18 |
| Synonyms | TL6; AITRL; GITRL; TNLG2A; hGITRL |
| Gene ID | 8995 |
| mRNA Refseq | NM_005092.4 |
| Protein Refseq | NP_005083.3 |
| MIM | 603898 |
| UniProt ID | Q9UNG2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF18 Products
Required fields are marked with *
My Review for All TNFSF18 Products
Required fields are marked with *
