Recombinant Full Length Human TNNT1 Protein, C-Flag-tagged
Cat.No. : | TNNT1-1915HFL |
Product Overview : | Recombinant Full Length Human TNNT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.8 kDa |
AA Sequence : | MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKR MEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEA KKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLRARSAWL PPSQPSCPAREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | TNNT1 troponin T1, slow skeletal type [ Homo sapiens (human) ] |
Official Symbol | TNNT1 |
Synonyms | ANM; TNT; NEM5; STNT; TNTS |
Gene ID | 7138 |
mRNA Refseq | NM_003283.6 |
Protein Refseq | NP_003274.3 |
MIM | 191041 |
UniProt ID | P13805 |
◆ Recombinant Proteins | ||
TNNT1-2228H | Recombinant Human TNNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNNT1-6210R | Recombinant Rat TNNT1 Protein | +Inquiry |
TNNT1-606H | Recombinant Human TNNT1 Protein, DDK-tagged | +Inquiry |
TNNT1-9626Z | Recombinant Zebrafish TNNT1 | +Inquiry |
TNNT1-7947H | Recombinant Human TNNT1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNT1-881HCL | Recombinant Human TNNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNNT1 Products
Required fields are marked with *
My Review for All TNNT1 Products
Required fields are marked with *
0
Inquiry Basket