Recombinant Full Length Human TPPP3 Protein, C-Flag-tagged
Cat.No. : | TPPP3-1956HFL |
Product Overview : | Recombinant Full Length Human TPPP3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables tubulin binding activity. Involved in decidualization and microtubule bundle formation. Colocalizes with microtubule bundle and perinuclear region of cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 18.8 kDa |
AA Sequence : | MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | TPPP3 tubulin polymerization promoting protein family member 3 [ Homo sapiens (human) ] |
Official Symbol | TPPP3 |
Synonyms | p20; CGI-38; TPPP/p20; p25gamma |
Gene ID | 51673 |
mRNA Refseq | NM_016140.4 |
Protein Refseq | NP_057224 |
MIM | 616957 |
UniProt ID | Q9BW30 |
◆ Recombinant Proteins | ||
TPPP3-17266M | Recombinant Mouse TPPP3 Protein | +Inquiry |
Tppp3-6607M | Recombinant Mouse Tppp3 Protein, Myc/DDK-tagged | +Inquiry |
TPPP3-5113H | Recombinant Human TPPP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TPPP3-11481Z | Recombinant Zebrafish TPPP3 | +Inquiry |
TPPP3-560H | Recombinant Human TPPP3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPPP3-343HCL | Recombinant Human TPPP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPPP3 Products
Required fields are marked with *
My Review for All TPPP3 Products
Required fields are marked with *
0
Inquiry Basket