Recombinant Full Length Human TPPP3 Protein, C-Flag-tagged

• Cat.No.: TPPP3-1956HFL
• Product Overview: Recombinant Full Length Human TPPP3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables tubulin binding activity. Involved in decidualization and microtubule bundle formation. Colocalizes with microtubule bundle and perinuclear region of cytoplasm.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 18.8 kDa
• AA Sequence: MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: TPPP3 tubulin polymerization promoting protein family member 3 [ Homo sapiens (human) ]
• Official Symbol: TPPP3
• Synonyms: p20; CGI-38; TPPP/p20; p25gamma
• Gene ID: 51673
• mRNA Refseq: NM_016140.4
• Protein Refseq: NP_057224
• MIM: 616957
• UniProt ID: Q9BW30