Recombinant Full Length Human TPPP3 Protein, C-Flag-tagged

Cat.No. : TPPP3-1956HFL
Product Overview : Recombinant Full Length Human TPPP3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Enables tubulin binding activity. Involved in decidualization and microtubule bundle formation. Colocalizes with microtubule bundle and perinuclear region of cytoplasm.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 18.8 kDa
AA Sequence : MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVI NYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFD ESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Full Length : Full L.
Gene Name TPPP3 tubulin polymerization promoting protein family member 3 [ Homo sapiens (human) ]
Official Symbol TPPP3
Synonyms p20; CGI-38; TPPP/p20; p25gamma
Gene ID 51673
mRNA Refseq NM_016140.4
Protein Refseq NP_057224
MIM 616957
UniProt ID Q9BW30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPPP3 Products

Required fields are marked with *

My Review for All TPPP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon