Recombinant Full Length Human TPPP3 Protein, GST-tagged
| Cat.No. : | TPPP3-3548HF |
| Product Overview : | Human TPPP3 full-length ORF (NP_057048.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 176 amino acids |
| Description : | TPPP3 (Tubulin Polymerization Promoting Protein Family Member 3) is a Protein Coding gene. Diseases associated with TPPP3 include Cerebrospinal Fluid Leak and Creutzfeldt-Jakob Disease. GO annotations related to this gene include tubulin binding. An important paralog of this gene is TPPP. |
| Molecular Mass : | 45.4 kDa |
| AA Sequence : | MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | TPPP3 tubulin polymerization-promoting protein family member 3 [Homo sapiens (human) ] |
| Official Symbol | TPPP3 |
| Synonyms | TPPP3; p20; CGI-38; p25gamma; tubulin polymerization-promoting protein family member 3; TPPP/p20; brain specific protein |
| Gene ID | 51673 |
| mRNA Refseq | NM_015964 |
| Protein Refseq | NP_057048 |
| MIM | 616957 |
| UniProt ID | Q9BW30 |
| ◆ Recombinant Proteins | ||
| TPPP3-6187H | Recombinant Human TPPP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| TPPP3-560H | Recombinant Human TPPP3 protein, His-tagged | +Inquiry |
| TPPP3-1956HFL | Recombinant Full Length Human TPPP3 Protein, C-Flag-tagged | +Inquiry |
| TPPP3-4922R | Recombinant Rhesus monkey TPPP3 Protein, His-tagged | +Inquiry |
| TPPP3-1332H | Recombinant Human TPPP3 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPPP3-343HCL | Recombinant Human TPPP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPPP3 Products
Required fields are marked with *
My Review for All TPPP3 Products
Required fields are marked with *
