Recombinant Full Length Human TPPP3 Protein, GST-tagged

Cat.No. : TPPP3-3548HF
Product Overview : Human TPPP3 full-length ORF (NP_057048.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 176 amino acids
Description : TPPP3 (Tubulin Polymerization Promoting Protein Family Member 3) is a Protein Coding gene. Diseases associated with TPPP3 include Cerebrospinal Fluid Leak and Creutzfeldt-Jakob Disease. GO annotations related to this gene include tubulin binding. An important paralog of this gene is TPPP.
Molecular Mass : 45.4 kDa
AA Sequence : MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TPPP3 tubulin polymerization-promoting protein family member 3 [Homo sapiens (human) ]
Official Symbol TPPP3
Synonyms TPPP3; p20; CGI-38; p25gamma; tubulin polymerization-promoting protein family member 3; TPPP/p20; brain specific protein
Gene ID 51673
mRNA Refseq NM_015964
Protein Refseq NP_057048
MIM 616957
UniProt ID Q9BW30

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPPP3 Products

Required fields are marked with *

My Review for All TPPP3 Products

Required fields are marked with *

0
cart-icon