Recombinant Full Length Human TPRG1 Protein, GST-tagged

Cat.No. : TPRG1-4752HF
Product Overview : Human FAM79B full-length ORF ( NP_940887.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 275 amino acids
Description : TPRG1 (Tumor Protein P63 Regulated 1) is a Protein Coding gene. An important paralog of this gene is TPRG1L.
Molecular Mass : 57.6 kDa
AA Sequence : MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMSLDKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TPRG1 tumor protein p63 regulated 1 [ Homo sapiens ]
Official Symbol TPRG1
Synonyms TPRG1; tumor protein p63 regulated 1; FAM79B, family with sequence similarity 79, member B; tumor protein p63-regulated gene 1 protein; FLJ41238; FLJ43694; family with sequence similarity 79, member B; FAM79B; MGC126599; MGC126601;
Gene ID 285386
mRNA Refseq NM_198485
Protein Refseq NP_940887
UniProt ID Q6ZUI0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TPRG1 Products

Required fields are marked with *

My Review for All TPRG1 Products

Required fields are marked with *

0
cart-icon