Recombinant Human TPRG1 Protein, GST-tagged
Cat.No. : | TPRG1-4049H |
Product Overview : | Human FAM79B full-length ORF ( NP_940887.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | TPRG1 (Tumor Protein P63 Regulated 1) is a Protein Coding gene. An important paralog of this gene is TPRG1L. |
Molecular Mass : | 57.6 kDa |
AA Sequence : | MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMSLDKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TPRG1 tumor protein p63 regulated 1 [ Homo sapiens ] |
Official Symbol | TPRG1 |
Synonyms | TPRG1; tumor protein p63 regulated 1; FAM79B, family with sequence similarity 79, member B; tumor protein p63-regulated gene 1 protein; FLJ41238; FLJ43694; family with sequence similarity 79, member B; FAM79B; MGC126599; MGC126601; |
Gene ID | 285386 |
mRNA Refseq | NM_198485 |
Protein Refseq | NP_940887 |
UniProt ID | Q6ZUI0 |
◆ Recombinant Proteins | ||
TPRG1-3376H | Recombinant Human TPRG1, GST-tagged | +Inquiry |
TPRG1-4049H | Recombinant Human TPRG1 Protein, GST-tagged | +Inquiry |
TPRG1-4752HF | Recombinant Full Length Human TPRG1 Protein, GST-tagged | +Inquiry |
TPRG1-5617Z | Recombinant Zebrafish TPRG1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPRG1-837HCL | Recombinant Human TPRG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPRG1 Products
Required fields are marked with *
My Review for All TPRG1 Products
Required fields are marked with *