Recombinant Human TPRG1 Protein, GST-tagged

• Cat.No.: TPRG1-4049H
• Product Overview: Human FAM79B full-length ORF ( NP_940887.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: TPRG1 (Tumor Protein P63 Regulated 1) is a Protein Coding gene. An important paralog of this gene is TPRG1L.
• Molecular Mass: 57.6 kDa
• AA Sequence: MSTIGSFEGFQAVSLKQEGDDQPSETDHLSMEEEDPMPRQISRQSSVTESTLYPNPYHQPYISRKYFATRPGAIETAMEDLKGHVAETSGETIQGFWLLTKIDHWNNEKERILLVTDKTLLICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMSLDKRQGEGLRIYWGSPEEQSLLSRWNPWSTEVPYATFTEHPMKYTSEKFLEICKLSGFMSKLVPAIQNAHKNSTGSGRGKKLMVLTEPILIETYTGLMSFIGNRNKLGYSLARGSIGF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TPRG1 tumor protein p63 regulated 1 [ Homo sapiens ]
• Official Symbol: TPRG1
• Synonyms: TPRG1; tumor protein p63 regulated 1; FAM79B, family with sequence similarity 79, member B; tumor protein p63-regulated gene 1 protein; FLJ41238; FLJ43694; family with sequence similarity 79, member B; FAM79B; MGC126599; MGC126601
• Gene ID: 285386
• mRNA Refseq: NM_198485
• Protein Refseq: NP_940887
• UniProt ID: Q6ZUI0