Recombinant Full Length Human Transmembrane Protein 88(Tmem88) Protein, His-Tagged
Cat.No. : | RFL30380HF |
Product Overview : | Recombinant Full Length Human Transmembrane protein 88(TMEM88) Protein (Q6PEY1) (1-159aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-159) |
Form : | Lyophilized powder |
AA Sequence : | MADVPGAQRAVPGDGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLVLVLGTILLPAVTM LGFGFLCHSQFLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLA DCLVPYSRALYRRRRAPQPRQIRASPGSQAVPTSGKVWV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM88 |
Synonyms | TMEM88; TMEM88A; Transmembrane protein 88 |
UniProt ID | Q6PEY1 |
◆ Recombinant Proteins | ||
RFL5985BF | Recombinant Full Length Bovine Transmembrane Protein 88(Tmem88) Protein, His-Tagged | +Inquiry |
TMEM88-9432M | Recombinant Mouse TMEM88 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tmem88-6517M | Recombinant Mouse Tmem88 Protein, Myc/DDK-tagged | +Inquiry |
TMEM88-4842R | Recombinant Rhesus monkey TMEM88 Protein, His-tagged | +Inquiry |
TMEM88-17088M | Recombinant Mouse TMEM88 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMEM88 Products
Required fields are marked with *
My Review for All TMEM88 Products
Required fields are marked with *