Recombinant Full Length Human TRMO Protein, GST-tagged

• Cat.No.: TRMO-2690HF
• Product Overview: Human C9orf156 full-length ORF (AAH02863.1, 1 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 441 amino acids
• Description: TRMO (TRNA Methyltransferase O) is a Protein Coding gene. Diseases associated with TRMO include Isolated Cleft Lip.
• Molecular Mass: 75 kDa
• AA Sequence: MRGLEEPGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLGQLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRIKPASEPVHMTGPVGSLVSLGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TRMO tRNA methyltransferase O [ Homo sapiens (human) ]
• Official Symbol: TRMO
• Synonyms: TRMO; tRNA methyltransferase O; C9ORF156; chromosome 9 open reading frame 156; nef-associated protein 1; HSPC219; NAP1; Nef (lentivirus myristoylated factor) associated protein 1; thioesterase NAP1; Nef associated protein 1; RP11-23B15.3
• Gene ID: 51531
• mRNA Refseq: NM_016481
• Protein Refseq: NP_057565
• UniProt ID: Q9BU70