Recombinant Human TRMO Protein, GST-Tagged

Cat.No. : TRMO-0189H
Product Overview : Human C9orf156 full-length ORF (AAH02863.1, 1 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : TRMO (TRNA Methyltransferase O) is a Protein Coding gene. Diseases associated with TRMO include Isolated Cleft Lip.
Molecular Mass : 75 kDa
AA Sequence : MRGLEEPGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLGQLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRIKPASEPVHMTGPVGSLVSLGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name TRMO tRNA methyltransferase O [ Homo sapiens (human) ]
Official Symbol TRMO
Synonyms TRMO; tRNA methyltransferase O; C9ORF156; chromosome 9 open reading frame 156; nef-associated protein 1; HSPC219; NAP1; Nef (lentivirus myristoylated factor) associated protein 1; thioesterase NAP1; Nef associated protein 1; RP11-23B15.3;
Gene ID 51531
mRNA Refseq NM_016481
Protein Refseq NP_057565
UniProt ID Q9BU70

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TRMO Products

Required fields are marked with *

My Review for All TRMO Products

Required fields are marked with *

0
cart-icon